ANTI-HERPESVIRAL AGENTS AND ASSAYS THEREFOR
There is described an antiviral agent capable of disrupting the association of two viral structural proteins required for maturation, replication and infection of herpesviruses. The agents are based upon VP22 and disrupt the normal association of that protein with VP16 and/or gB. Suitable agents are...
Saved in:
Main Authors | , , , |
---|---|
Format | Patent |
Language | English French |
Published |
05.02.1998
|
Edition | 6 |
Subjects | |
Online Access | Get full text |
Cover
Loading…
Summary: | There is described an antiviral agent capable of disrupting the association of two viral structural proteins required for maturation, replication and infection of herpesviruses. The agents are based upon VP22 and disrupt the normal association of that protein with VP16 and/or gB. Suitable agents are peptides having the amino acid sequences TPRVAGFNKRVFCAAVGRLAAMHARMAAVQLW or ITTIRVTVCEGKNLLQRANE or portions or functional equivalents thereof. The agents are suitable for combatting infection of herpesviruses and thus for the treatment of cold sores, genital herpes, chickenpox and shingles. An assay to test for agents able to disrupt VP22/V16 and/or VP22/gB association is also described.
Agent antiviral capable d'interrompre l'association des deux protéines structurelles virales nécessaires à la maturation, à la réplication et à l'activité infectieuse des virus herpétiques. Ces agents sont basés sur VP22 et interrompent l'association normale de cette protéine avec VP16 et/ou gB. Les agents antiviraux appropriés sont des peptides possédant les séquences d'acides aminés TPRVAGFNKRVFCAAVGRLAAMHARMAAVQLW ou ITTIRVTVCEGKNLLQRANE ou des parties ou des équivalents fonctionnels de ces dernières. Ces agents sont utiles pour combattre les infections à herpèsvirus donc pour le traitement de l'herpès labial, de l'herpès génital, de la varicelle et des zonas. L'invention porte également sur une méthode pour identifier les agents capables d'interrompre l'association VP22/V16 et/ou VP22/gB. |
---|---|
Bibliography: | Application Number: WO1997GB02036 |