Anticuerpos humanizados anti-antígeno-TF

Un anticuerpo monoclonal (mAb) que se une con especificidad a Galβ1-3GalNAc-α de TF-Ag, el anticuerpo monoclonal comprende una cadena pesada y una cadena ligera, en donde la cadena pesada comprende una secuencia que consiste en: QVQLVQSGAEVKKPGSSVKVSCKASGYTFTTYWMHWVRQAPGQGLEWMGFISPNT DYTEYNQKFRDRVTI...

Full description

Saved in:
Bibliographic Details
Main Authors KOURY, Stephen T, ABDULLAH, Julia, ENG, Jing Ying, RITTENHOUSE-OLSON, Kate
Format Patent
LanguageSpanish
Published 19.07.2021
Subjects
Online AccessGet full text

Cover

Loading…
More Information
Summary:Un anticuerpo monoclonal (mAb) que se une con especificidad a Galβ1-3GalNAc-α de TF-Ag, el anticuerpo monoclonal comprende una cadena pesada y una cadena ligera, en donde la cadena pesada comprende una secuencia que consiste en: QVQLVQSGAEVKKPGSSVKVSCKASGYTFTTYWMHWVRQAPGQGLEWMGFISPNT DYTEYNQKFRDRVTITADKSTSTAYMELSSLRSEDTAVYYCARSFIGYNFDFWGQGT TVTVS (SEQ ID NO: 13) (H2a); y en donde la cadena ligera comprende una secuencia que consiste en: DIVMTQSPLSLPVTPGEPASISCRSSQTIVYSNGNTYLEWYLQKPGQSPQLLIYKVSNR FSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPFTFGSGTKVDIK (SEQ ID NO: 15) (L2a). Provided are humanized monoclonal antibodies (mAbs) or fragments thereof that bind with specificity to the Thomsen-Friedenreich (TF) human tumor antigen. Three distinct variable heavy and three variable light chains are provided, and can be combined to make a total of twenty-five distinct heavy and light chain combinations. Methods of using the mAbs and fragments thereof for cancer therapy and diagnostic imaging are provided, as are methods for making the mAbs and fragments thereof. In vitro cell cultures that express the mAbs and fragments thereof, and kits are also provided.
Bibliography:Application Number: ES20150780559T