Human beta-defensin 1 isolated from haemofiltrate
beta -defensin, hBD-1, of formula (I) and its biologically active fragments and/or derivs. (esp. amidated, acetylated, sulphated, phosphorylated and/or glycosylated) are new: DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (I). Also new is nucleic acid (II), pref. the 108 base sequence given in the specificati...
Saved in:
Main Authors | , , |
---|---|
Format | Patent |
Language | English German |
Published |
08.02.1996
|
Edition | 6 |
Subjects | |
Online Access | Get full text |
Cover
Loading…
Summary: | beta -defensin, hBD-1, of formula (I) and its biologically active fragments and/or derivs. (esp. amidated, acetylated, sulphated, phosphorylated and/or glycosylated) are new: DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (I). Also new is nucleic acid (II), pref. the 108 base sequence given in the specification, encoding (I) or its fragments. |
---|---|
Bibliography: | Application Number: DE19944427531 |