Effects of Muscarinic Acetylcholine 3 Receptor 208-227 Peptide Immunization on Autoimmune Response in Nonobese Diabetic Mice
The second extracellular loop (LFWQYFVGKRTVPPGECFIQFLSEPTITFGTAI, aa 205–237) of muscarinic acetylcholine 3 receptor (M3R) has been reported to be an epitope for autoantibodies generated during certain autoimmune disorders, including Sjögren’s syndrome (SS). Autoantibodies against M3R 228–237 have b...
Saved in:
Published in | Clinical & developmental immunology Vol. 2013; pp. 1 - 10 |
---|---|
Main Authors | , , , , , , |
Format | Journal Article |
Language | English |
Published |
2013
|
Online Access | Get full text |
Cover
Loading…
Summary: | The second extracellular loop (LFWQYFVGKRTVPPGECFIQFLSEPTITFGTAI, aa 205–237) of muscarinic acetylcholine 3 receptor (M3R) has been reported to be an epitope for autoantibodies generated during certain autoimmune disorders, including Sjögren’s syndrome (SS). Autoantibodies against M3R
228–237
have been shown to interfere with the function of M3R. However, few studies have been performed on the M3R
205–227
peptide of the second extracellular loop. In the current study, we sought to investigate the effect of M3R
208–227
peptide immunization on autoimmune response in NOD/LtJ mice. We synthesized the M3R
208–227
peptide and immunized NOD/LtJ mice to investigate whether peptide-specific antibodies could be generated and whether immunization would lead to changes in autoimmune response in NOD/LtJ mice. Our results demonstrate that the secretions of Th-1, Th-2, and Th-17 cytokines are downregulated and lymphocytic infiltration is improved in the salivary glands and lacrimal glands following immunization with M3R
208–227
peptide in NOD/LtJ mice, suggesting that peptide immunotherapy using the M3R
208–227
peptide may represent a potential therapeutic alternative. |
---|---|
ISSN: | 1740-2522 1740-2530 |
DOI: | 10.1155/2013/485213 |